PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen03g037080.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family LFY
Protein Properties Length: 412aa    MW: 45962.6 Da    PI: 6.5922
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen03g037080.2genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY638.31.2e-19413941386
           FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseap............leaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdm 81 
                       mdp+afsaslfkwdpr a+ +pp+rlle  a +++p            +++ +  ++r+l +leelf+ayG+ry+t+akiaelGftv+tL+dm
  Sopen03g037080.2   1 MDPDAFSASLFKWDPRGAM-PPPSRLLEPVAPPQPPpplpppppqplpTSSYSIRSTRELGGLEELFQAYGIRYYTAAKIAELGFTVNTLLDM 92 
                       9**************9877.66777777776666555677775555444444444455566******************************** PP

           FLO_LFY  82 kdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeg.lseepvqeekeaagsggeglgeael 173
                       kdeeldd+m+sls+ifr+dllvGeryGikaa+rae rrleeee +++r ++ls+  +++ldalsqe+ lseepvq+++e+ ++g +g g++e+
  Sopen03g037080.2  93 KDEELDDMMNSLSQIFRWDLLVGERYGIKAAIRAEWRRLEEEE-ARRRGHILSDGGTNVLDALSQEVgLSEEPVQQQHEREAAGSGGGGTWEV 184
                       *****************************************88.88888999999999********55******9977765555566669999 PP

           FLO_LFY 174 vaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqv 266
                       +a    +++++++k+ + +++r ++++  ++e+  ee+ee+ ++ g+g + +erqrehPfivtepgevargkknGLDYLf+LyeqCr+fL+qv
  Sopen03g037080.2 185 AAGGGGRMKQRRRKK-AGRERRGEEDD--ETEELGEEDEENMNGGGGGGGISERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCRDFLIQV 274
                       999875554444444.23444444333..33334444445555555666667***************************************** PP

           FLO_LFY 267 qkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavf 359
                       q+iakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLde+asnalrrafkergenvGawrqacykplvaiaarqgwdida+f
  Sopen03g037080.2 275 QTIAKERGEKCPTKVTNQVFRYAKKAGASYINKPKMRHYVHCYALHCLDEDASNALRRAFKERGENVGAWRQACYKPLVAIAARQGWDIDAIF 367
                       ********************************************************************************************* PP

           FLO_LFY 360 nahprLsiWYvPtkLrqLChlerskas 386
                       nahprL+iWYvPtkLrqLCh ers+a+
  Sopen03g037080.2 368 NAHPRLAIWYVPTKLRQLCHSERSNAA 394
                       ************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016985.8E-2141394IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MDPDAFSASL FKWDPRGAMP PPSRLLEPVA PPQPPPPLPP PPPQPLPTSS YSIRSTRELG  60
GLEELFQAYG IRYYTAAKIA ELGFTVNTLL DMKDEELDDM MNSLSQIFRW DLLVGERYGI  120
KAAIRAEWRR LEEEEARRRG HILSDGGTNV LDALSQEVGL SEEPVQQQHE REAAGSGGGG  180
TWEVAAGGGG RMKQRRRKKA GRERRGEEDD ETEELGEEDE ENMNGGGGGG GISERQREHP  240
FIVTEPGEVA RGKKNGLDYL FHLYEQCRDF LIQVQTIAKE RGEKCPTKVT NQVFRYAKKA  300
GASYINKPKM RHYVHCYALH CLDEDASNAL RRAFKERGEN VGAWRQACYK PLVAIAARQG  360
WDIDAIFNAH PRLAIWYVPT KLRQLCHSER SNAATAASSS VSGGVADHLP HF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy2_A1e-1102334033173PROTEIN LEAFY
2vy1_A1e-1102334033173PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1979340.0AF197934.1 Lycopersicon esculentum FLORICAULA/LEAFY-like protein (FALSIFLORA) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015069882.10.0PREDICTED: protein ALF
SwissprotQ405050.0FL2_TOBAC; Floricaula/leafy homolog 2
TrEMBLA0N0C70.0A0N0C7_SOLTU; LEAFY/FLORICAULA
STRINGSolyc03g118160.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA66682333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-104floral meristem identity control protein LEAFY (LFY)